Product Description
Size: 20ul / 150ul
The BET1L (14163-1-AP) by Proteintech is a Polyclonal antibody targeting BET1L in WB, IHC, ELISA applications with reactivity to human, mouse samples
14163-1-AP targets BET1L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, MCF-7 cells
Positive IHC detected in: human cervical cancer tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag5351 Product name: Recombinant human GS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC032779 Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP Predict reactive species
Full Name: blocked early in transport 1 homolog (S. cerevisiae)-like
Calculated Molecular Weight: 102 aa, 11 kDa
Observed Molecular Weight: 13-15 kDa
GenBank Accession Number: BC032779
Gene Symbol: BET1L
Gene ID (NCBI): 51272
RRID: AB_2064737
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NYM9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924