Iright
BRAND / VENDOR: Proteintech

Proteintech, 14186-1-AP, UPP1 Polyclonal antibody

CATALOG NUMBER: 14186-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UPP1 (14186-1-AP) by Proteintech is a Polyclonal antibody targeting UPP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14186-1-AP targets UPP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, SGC-7901 cells Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Uridine phosphorylase 1 (UPP1) belongs to the purine/pyrimidine phosphorylase family. It is an enzyme that catalyzes the reversible conversion of uridine to uracil and ribose-1-phosphate. UPP1 plays a crucial role in pyrimidine metabolism. UPP1 is highly expressed in various cancers, aiding in metabolic reprogramming, tumor growth, and immune evasion. The apparent molecular mass measured by SDS-PAGE is 34 kDa. The post-translational modification of UPP1 is primarily ubiquitination. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5441 Product name: Recombinant human UPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC047030 Sequence: MQRKLKVTSLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKA Predict reactive species Full Name: uridine phosphorylase 1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC047030 Gene Symbol: UPP1 Gene ID (NCBI): 7378 RRID: AB_2878025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924