Iright
BRAND / VENDOR: Proteintech

Proteintech, 14192-1-AP, HSD11B2 Polyclonal antibody

CATALOG NUMBER: 14192-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSD11B2 (14192-1-AP) by Proteintech is a Polyclonal antibody targeting HSD11B2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14192-1-AP targets HSD11B2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse kidney tissue, human kidney tissue, Transfected HEK-293 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The HSD11B2 gene encodes the type II isoform of 11-beta-hydroxysteroid dehydrogenase, a microsomal enzyme complex responsible for the interconversion of biologically active cortisol and inactive cortisone. This protein catalyzes the cortisol-to-cortisone reaction. This protein expresses approximately 44 kDa in placenta, trophoblast, and distal colon, but in kidney tissue, there are two bands of approximately 44 and 48 kDa can be consistently observed and no signal is seen in decidua, adrenal, or liver(PMID:9048640). HSD11B2 protein was detected in CEM-C7 cells via immunoblot analysis as a dimer and trimer of approximately 80 and 120 kDa (PMID:23762608). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5146 Product name: Recombinant human HSD11B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-405 aa of BC036780 Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQGPNLSPGPSPAVAR Predict reactive species Full Name: hydroxysteroid (11-beta) dehydrogenase 2 Calculated Molecular Weight: 405 aa, 44 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC036780 Gene Symbol: HSD11B2 Gene ID (NCBI): 3291 RRID: AB_2119643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P80365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924