Iright
BRAND / VENDOR: Proteintech

Proteintech, 14196-1-AP, CREB5 Polyclonal antibody

CATALOG NUMBER: 14196-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CREB5 (14196-1-AP) by Proteintech is a Polyclonal antibody targeting CREB5 in WB, ELISA applications with reactivity to human samples 14196-1-AP targets CREB5 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, human brain tissue, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3200 Background Information cyclic AMP responsive element binding protein 5 (CREB5), also known as CRE-BPA, a member of the cAMP response element binding protein family, is a transcription factor specifically expressed in superficial zone articular chondrocytes and is required for TGF-β and EGFR signaling. Knockdown of CREB5 decreased the c-jun and c-fos expression levels in HC-a cells (PMID: 38549717). Increased CREB5 expression is positively correlated with tumor cell invasion and a poor prognosis for cancer patients with epithelial ovarian cancer and hepatocellular carcinoma (PMID: 38418476).This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified (PMID: 33712729). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5399 Product name: Recombinant human CREB5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-369 aa of BC059400 Sequence: MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL Predict reactive species Full Name: cAMP responsive element binding protein 5 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC059400 Gene Symbol: CREB5 Gene ID (NCBI): 9586 RRID: AB_2083832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02930 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924