Iright
BRAND / VENDOR: Proteintech

Proteintech, 14204-1-AP, PLEKHH2 Polyclonal antibody

CATALOG NUMBER: 14204-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLEKHH2 (14204-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHH2 in WB, ELISA applications with reactivity to human, mouse, rat samples 14204-1-AP targets PLEKHH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information PLEKHH2 is a 1491-residue intracellular protein highly enriched in renal glomerular podocytes. PLEKHH2 is one of two previously uncharacterized PLEKHH proteins encoded in the mammalian genomes. A PLEKHH ortholog has also been described in Drosophila, Caenorhabditis elegans, and zebrafish. In C. elegans, the loss of the protein was found to cause variable axon guidance defects. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5409 Product name: Recombinant human PLEKHH2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-357 aa of BC063310 Sequence: MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAFQQVQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDVIQNLELQLEEQKQIRIQEAKIIEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKLSEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKEPEFTEGKDMEEMEIPEKSVDNQVLENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSGAPVSDWSSDEEDGSKGRSKSRCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQE Predict reactive species Full Name: pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 Calculated Molecular Weight: 168 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC063310 Gene Symbol: PLEKHH2 Gene ID (NCBI): 130271 RRID: AB_2878027 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924