Proteintech, 14226-1-AP, S100A9 Polyclonal antibody

Size: 20ul / 150ul The S100A9 (14226-1-AP) by Proteintech is a Polyclonal antibody targeting S100A9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14226-1-AP targets S100A9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, human blood, human heart tissue, MCF-7 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human breast cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5465 Product name: Recombinant human S100A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC047681 Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species Full Name: S100 calcium binding protein A9 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 14 kDa, 28 kDa GenBank Accession Number: BC047681 Gene Symbol: S100A9 Gene ID (NCBI): 6280 RRID: AB_2254232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.