Iright
BRAND / VENDOR: Proteintech

Proteintech, 14243-1-AP, ENPP2 Polyclonal antibody

CATALOG NUMBER: 14243-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ENPP2 (14243-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14243-1-AP targets ENPP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human placenta tissue, mouse kidney tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human liver cancer tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ENPP2, Autotaxin or Extracellular lysophospholipase D, is a 863 amino acid secreted protein, which is detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). ENPP2 is Predominantly expressed in brain, placenta, ovary, and small intestine. ENPP2 is expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. ENPP2 is expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. The calculated molecular weight of ENPP2 is about 100 kDa (PMID: 22301782), but modified ENPP2 is 120 kDa (PMID: 19808661). ENPP2 Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:15769751, PubMed:26371182, PubMed:27754931). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5499 Product name: Recombinant human ENPP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-383 aa of BC034961 Sequence: AHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDI Predict reactive species Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 2 Calculated Molecular Weight: 99 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC034961 Gene Symbol: ENPP2 Gene ID (NCBI): 5168 RRID: AB_2878033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13822 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924