Iright
BRAND / VENDOR: Proteintech

Proteintech, 14248-1-AP, TFCP2L1 Polyclonal antibody

CATALOG NUMBER: 14248-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFCP2L1 (14248-1-AP) by Proteintech is a Polyclonal antibody targeting TFCP2L1 in WB, ELISA applications with reactivity to human samples 14248-1-AP targets TFCP2L1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Transcription factor CP2-like protein 1 (TFCP2L1) is a transcriptional regulator critical for maintaining mouse and human embryonic stem cell (ESC) pluripotency. The deletion of TFCP2L1 in mice reduced the expression of renal cell markers including ion transporters and cell identity proteins expressed in different segments of the distal nephron (PMID: 33097957). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5520 Product name: Recombinant human TFCP2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-479 aa of BC064698 Sequence: LDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL Predict reactive species Full Name: transcription factor CP2-like 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC064698 Gene Symbol: TFCP2L1 Gene ID (NCBI): 29842 RRID: AB_2878034 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924