Proteintech, 14250-1-AP, CENPC Polyclonal antibody

Size: 20ul / 150ul The CENPC (14250-1-AP) by Proteintech is a Polyclonal antibody targeting CENPC in WB, ELISA applications with reactivity to human, mouse samples 14250-1-AP targets CENPC in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5523 Product name: Recombinant human CENPC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 598-943 aa of BC041117 Sequence: EGSGGIVGHDEISRCSLSEPLESDEADLAKKKNLDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDLVRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLLCTLHETPYILSTGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR Predict reactive species Full Name: centromere protein C 1 Calculated Molecular Weight: 107 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC041117 Gene Symbol: CENPC Gene ID (NCBI): 1060 RRID: AB_10642008 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03188 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.