Proteintech, 14253-1-AP, UBL4A Polyclonal antibody

Size: 20ul / 150ul The UBL4A (14253-1-AP) by Proteintech is a Polyclonal antibody targeting UBL4A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14253-1-AP targets UBL4A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HUVEC cells, mouse testis tissue, human brain tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5526 Product name: Recombinant human UBL4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC043346 Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK Predict reactive species Full Name: ubiquitin-like 4A Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC043346 Gene Symbol: UBL4A Gene ID (NCBI): 8266 RRID: AB_2288205 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11441 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.