Proteintech, 14286-1-AP, HLTF Polyclonal antibody

Size: 20ul / 150ul The HLTF (14286-1-AP) by Proteintech is a Polyclonal antibody targeting HLTF in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14286-1-AP targets HLTF in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IP detected in: HeLa cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Helicase-like Transcription Factor (HLTF) is a crucial nuclear protein and member of the SWI/SNF family of chromatin-remodeling complexes, playing a dual role in transcription regulation and DNA damage repair. It functions dually as a regulator of gene expression, utilizing its ATP-dependent helicase activity to modify chromatin structure and facilitate transcription, and as a central effector in the DNA damage response pathway. HLTF is particularly crucial for promoting error-free DNA repair at stalled replication forks via a mechanism called template switching, which prevents the accumulation of mutagenic lesions. HLTF can be detected as 114 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5596 Product name: Recombinant human HLTF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC044659 Sequence: MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLS Predict reactive species Full Name: helicase-like transcription factor Calculated Molecular Weight: 114 kDa Observed Molecular Weight: 114 kDa GenBank Accession Number: BC044659 Gene Symbol: HLTF Gene ID (NCBI): 6596 RRID: AB_2279646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14527 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.