Proteintech, 14299-1-AP, GLUD1 Polyclonal antibody

Size: 20ul / 150ul The GLUD1 (14299-1-AP) by Proteintech is a Polyclonal antibody targeting GLUD1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 14299-1-AP targets GLUD1 in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse lung tissue, HepG2 cells, L02 cells, PC-3 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human gliomas tissue, human breast cancer tissue, human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF-Fro detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Human glutamate dehydrogenase (GDH), an enzyme central to the metabolism of glutamate, is known to exist in housekeeping and nerve tissue-specific isoforms encoded by the GLUD1 and GLUD2 genes, respectively. It catalyses the reversible inter-conversion of glutamate to alpha-ketoglutarate and ammonia, thus interconnecting amino acid and carbohydrate metabolism. GLUD1 might contribute to the formation of specific synapses in the hippocampus such as those formed by the projecting neurons of the entorhinal cortex(PMID: 22138648). GLUD1 has a calculated molecular mass of 61 kDa and an apparent molecular mass of 45-55 kDa with the 53aa transit peptide removed. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5694 Product name: Recombinant human GLUD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-558 aa of BC040132 Sequence: FIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT Predict reactive species Full Name: glutamate dehydrogenase 1 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC040132 Gene Symbol: GLUD1 Gene ID (NCBI): 2746 RRID: AB_2110515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00367 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.