Proteintech, 14300-1-AP, SULT1C4 Polyclonal antibody

Size: 20ul / 150ul The SULT1C4 (14300-1-AP) by Proteintech is a Polyclonal antibody targeting SULT1C4 in WB, ELISA applications with reactivity to human samples 14300-1-AP targets SULT1C4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SULT1C4 (Sulfotransferase 1C4), a member of a gene subfamily that includes three human members, SULT1C2, 1C3, and 1C4, is a dimeric Phase II drug-metabolizing enzyme primarily expressed in the developing fetus. SULT1C4 transcript is expressed in human intestinal and hepatic cell lines as well as in human liver specimens from different developmental stages, while SULT1C4 protein is barely detectable (PMID: 28222028, 32303576). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5259 Product name: Recombinant human SULT1C4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC058861 Sequence: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK Predict reactive species Full Name: sulfotransferase family, cytosolic, 1C, member 4 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC058861 Gene Symbol: SULT1C4 Gene ID (NCBI): 27233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75897 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.