Iright
BRAND / VENDOR: Proteintech

Proteintech, 14311-1-AP, Caspase 10 Polyclonal antibody

CATALOG NUMBER: 14311-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Caspase 10 (14311-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 10 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 14311-1-AP targets Caspase 10 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Staurosporine treated Jurkat cells, Apoptosised HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Caspase 10 (CASP10) is also called MCH4, is a member of the peptidase C14A family, and containstwo deatheffector (DED) domains.What is the molecular weight of CASP10?The molecular weight of CASP10 observed on Western blots may vary depending on which of its isoform,truncation, or cleavage forms are present. Full-length CASP10 has a propeptide with 219 amino acid and6 isoforms produced by alternative splicing.What is the tissue specificity of CASP10?CASP10 is detectable in most tissues. However, there is lower expression observed in brain, kidney, colon,prostate,and testis tissue.What is the function of CASP10?CASP10 plays a role in the cascade of caspases responsible for executing apoptosis. It is recruited toboththeFas and TNFR-1 receptors in a FADD dependentmanner.CASP10 is responsible forthe cleavageandactivation ofcaspases 3, 4, 6, 7, 8, and 9.CASP10 can be cleavedby granzyme Band autocatalytic activity togeneratetwoactive subunits from its inactive proenzyme form.What is the role of CASP10 in disease?Defects in CASP10 lead to autoimmune lymphoproliferative syndrome type 2A (ALPS2A), which is characterizedby abnormal lymphocyte and dendritic cell homeostasis, as well as immune regulatory defects (PMID:16446975).Defects in CASP10 are also a cause of familial non-Hodgkin lymphoma (NHL) and often marked by enlarged lymphnodes, weightloss and fever (PMID:12010812), and gastric cancers (GASC) (PMID:11973654). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5511 Product name: Recombinant human Caspase 10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 193-522 aa of BC042844 Sequence: AIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL Predict reactive species Full Name: caspase 10, apoptosis-related cysteine peptidase Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 59 kDa, 47 kDa, 30-35 kDa GenBank Accession Number: BC042844 Gene Symbol: Caspase 10 Gene ID (NCBI): 843 RRID: AB_2290777 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92851 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924