Iright
BRAND / VENDOR: Proteintech

Proteintech, 14319-1-AP, RPS19BP1 Polyclonal antibody

CATALOG NUMBER: 14319-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPS19BP1 (14319-1-AP) by Proteintech is a Polyclonal antibody targeting RPS19BP1 in WB, ELISA applications with reactivity to human samples 14319-1-AP targets RPS19BP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information RPS19BP1, also named as AROS and S19BP, is recently described as direct negative and positive regulators of SIRT1 activity. It enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5560 Product name: Recombinant human RPS19BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC047711 Sequence: MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS Predict reactive species Full Name: ribosomal protein S19 binding protein 1 Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC047711 Gene Symbol: RPS19BP1 Gene ID (NCBI): 91582 RRID: AB_3669183 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924