Proteintech, 14325-1-AP, MICB Polyclonal antibody

Size: 20ul / 150ul The MICB (14325-1-AP) by Proteintech is a Polyclonal antibody targeting MICB in IHC, ELISA applications with reactivity to human samples 14325-1-AP targets MICB in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5591 Product name: Recombinant human MICB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-269 aa of BC044218 Sequence: RYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPY Predict reactive species Full Name: MHC class I polypeptide-related sequence B Calculated Molecular Weight: 43 kDa GenBank Accession Number: BC044218 Gene Symbol: MICB Gene ID (NCBI): 4277 RRID: AB_2878045 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q29980 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.