Proteintech, 14349-1-AP, ARHGAP25 Polyclonal antibody

Size: 20ul / 150ul The ARHGAP25 (14349-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP25 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14349-1-AP targets ARHGAP25 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, Ramos cells, THP-1 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ARHGAP25 (Rho GTPase-activating protein 25) also known as KAIA0053, belongs to a family of Rho GTPase-modulating proteins which are implicated in actin remodeling,cell polarity, and cell migration. ARHGAP25 has a key role in the pathomechanism of autoantibody-induced arthritis in which it regulates inflammation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5691 Product name: Recombinant human ARHGAP25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-347 aa of BC039591 Sequence: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLF Predict reactive species Full Name: Rho GTPase activating protein 25 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC039591 Gene Symbol: ARHGAP25 Gene ID (NCBI): 9938 RRID: AB_2059273 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42331 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.