Iright
BRAND / VENDOR: Proteintech

Proteintech, 14387-1-AP, IGSF8/CD316 Polyclonal antibody

CATALOG NUMBER: 14387-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IGSF8/CD316 (14387-1-AP) by Proteintech is a Polyclonal antibody targeting IGSF8/CD316 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 14387-1-AP targets IGSF8/CD316 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, mouse brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information IGSF8 is also known as CD316, PGRL (PG regulatory-like protein), KAI/CD82-associated surface molecule, and CD81-binding partner 3 (CD81P3). IGSF8 contains four immunoglobulin domains, a transmembrane region, and a short cytoplasmic tail that does not bear any signature motif for signal transduction. IGSF8 is abundantly expressed in olfactory sensory neuron (OSN) axons and their developing synapses. (PMID: 17785435, PMID: 22687584) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5846 Product name: Recombinant human IGSF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-350 aa of BC053881 Sequence: MLGMGCWAREVLVPEGPLYRVAGTAVSISCNVTGYEGPAQQNFEWFLYRPEAPDTALGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQAQDAGIYECHTPSTDTRYLGSYSGKVELRVLPDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQTLSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPA Predict reactive species Full Name: immunoglobulin superfamily, member 8 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC053881 Gene Symbol: IGSF8 Gene ID (NCBI): 93185 RRID: AB_2121881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969P0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924