Iright
BRAND / VENDOR: Proteintech

Proteintech, 14397-1-AP, SCP2/SCPx Polyclonal antibody

CATALOG NUMBER: 14397-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCP2/SCPx (14397-1-AP) by Proteintech is a Polyclonal antibody targeting SCP2/SCPx in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14397-1-AP targets SCP2/SCPx in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, BxPC-3 cells, HepG2 cells, NIH/3T3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:300-1:1500 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. 14397-1-AP antibody recognizes the intact 58 kDa SCPx protein as well as 44-46 kDa thiolase (PMID: 35996156). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5895 Product name: Recombinant human SCPX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC067108 Sequence: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS Predict reactive species Full Name: sterol carrier protein 2 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 44-46 kDa, 58 kDa GenBank Accession Number: BC067108 Gene Symbol: SCP2 Gene ID (NCBI): 6342 RRID: AB_10644332 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22307 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924