Proteintech, 14398-1-AP, LDHD Polyclonal antibody

Size: 20ul / 150ul The LDHD (14398-1-AP) by Proteintech is a Polyclonal antibody targeting LDHD in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14398-1-AP targets LDHD in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, rat liver tissue Positive IHC detected in: human liver cancer tissue, human osteosarcoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Two naturally occurring forms of lactate dehydrogenase with similar but unique substrate specificities have been isolated in lower organisms including invertebrates, fungi, and prokaryotes. These dehydrogenase enzymes are L-lactate dehydrogenase and D-lactate dehydrogenase (LDHD) that are specific to the L and D isomers of lactate, respectively (PMID: 12127981). In lactic acid bacteria, LDHD plays a key role in anaerobic energy metabolism (PMID: 497162). Despite the identification of D-lactate and other D-2-hydroxyacids in prokaryotes, and the obvious connections and similarities to vertebrate metabolic pathways, very few mammalian D-2-hydroxyacid dehydrogenases have been found. LDHD has 2 isoforms with the molecular weight of 52 and 54kDa, and can be detected as 45-54 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5897 Product name: Recombinant human LDHD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-507 aa of BC047902 Sequence: GADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL Predict reactive species Full Name: lactate dehydrogenase D Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 45-54 kDa GenBank Accession Number: BC047902 Gene Symbol: LDHD Gene ID (NCBI): 197257 RRID: AB_2249831 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.