Proteintech, 14433-1-AP, STK17A Polyclonal antibody

Size: 20ul / 150ul The STK17A (14433-1-AP) by Proteintech is a Polyclonal antibody targeting STK17A in WB, IHC, ELISA applications with reactivity to human, mouse samples 14433-1-AP targets STK17A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BxPC-3 cells, human skeletal muscle tissue, mouse skeletal muscle tissue, NIH/3T3 cells Positive IHC detected in: human heart tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5811 Product name: Recombinant human STK17A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC047696 Sequence: MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSI Predict reactive species Full Name: serine/threonine kinase 17a Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47-53 kDa GenBank Accession Number: BC047696 Gene Symbol: STK17A Gene ID (NCBI): 9263 RRID: AB_10858629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UEE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.