Proteintech, 14494-1-AP, Gastrokine 1 Polyclonal antibody

Size: 20ul / 150ul The Gastrokine 1 (14494-1-AP) by Proteintech is a Polyclonal antibody targeting Gastrokine 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14494-1-AP targets Gastrokine 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human stomach tissue, mouse stomach tissue, rat stomach tissue Positive IHC detected in: human stomach tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1 may play an important role in normal gastric function and may be a gastric tumour suppressor. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5898 Product name: Recombinant human GKN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-196 aa of BC059778 Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN Predict reactive species Full Name: gastrokine 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC059778 Gene Symbol: Gastrokine 1 Gene ID (NCBI): 56287 RRID: AB_10863653 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.