Iright
BRAND / VENDOR: Proteintech

Proteintech, 14518-1-AP, ENSA Polyclonal antibody

CATALOG NUMBER: 14518-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ENSA (14518-1-AP) by Proteintech is a Polyclonal antibody targeting ENSA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 14518-1-AP targets ENSA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, COLO 320 cells, HeLa cells Positive IHC detected in: human small intestine tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Endosulfine alpha (ENSA) belongs to the highly conserved c-AMP-regulated phosphoprotein (ARPP) family and was originally identified as an endogenous ligand for the sulfonylurea receptor, which regulates insulin secretion and glucose metabolism.ENSA not only regulates the cell cycle by interacting with microtubule-associated serine/threonine protein kinase-like (MASTL) enzymes, but also influences tumor growth through its own methylation. Recent studies have shown that ENSA is an important regulator of cholesterol biosynthesis in triple-negative breast cancer (TNBC) and that it triggers tumor growth by promoting cholesterol biosynthesis in TNBC. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5982 Product name: Recombinant human ENSA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC004461 Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE Predict reactive species Full Name: endosulfine alpha Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC004461 Gene Symbol: ENSA Gene ID (NCBI): 2029 RRID: AB_10838808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43768 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924