Proteintech, 14524-1-AP, MYBBP1A Polyclonal antibody

Size: 20ul / 150ul The MYBBP1A (14524-1-AP) by Proteintech is a Polyclonal antibody targeting MYBBP1A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 14524-1-AP targets MYBBP1A in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information The protooncogene MYB is predominantly expressed in immature hemopoietic cells where it has an essential role in hemopoietic cell proliferation and differentiation. Oncogenically activated forms of MYB is generally N- and/or C-terminal truncations of the normal MYB protein. Removal of the C terminus of MYB disrupts or deletes a region termed the negative regulatory domain (NRD), resulting in an increase in DNA binding, transactivation, and transformation by MYB. One feature of the NRD is a leucine zipper-like motif [PMID: 8302594]. Murine Myb-binding protein-1a (MYBBP1A), originally called P160, was identified by its ability to interact specifically with Myb via this leucine zipper-like motif. MYBBP1A modulates MYB activity upon binding to the MYB NRD [PMID: 10644447, 9447996]. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6008 Product name: Recombinant human MYBBP1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 979-1328 aa of BC050546 Sequence: STALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHITGPVRPRRQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQQALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP Predict reactive species Full Name: MYB binding protein (P160) 1a Calculated Molecular Weight: 149 kDa Observed Molecular Weight: 150-160 kDa GenBank Accession Number: BC050546 Gene Symbol: MYBBP1A Gene ID (NCBI): 10514 RRID: AB_2148137 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQG0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.