Iright
BRAND / VENDOR: Proteintech

Proteintech, 14530-1-AP, RGS4 Polyclonal antibody

CATALOG NUMBER: 14530-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RGS4 (14530-1-AP) by Proteintech is a Polyclonal antibody targeting RGS4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14530-1-AP targets RGS4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, mouse brain tissue, PC-12 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human lung tissue, human brain tissue, mouse brain tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Regulator of G protein signaling (RGS) proteins are a large family of highly diverse, multifunctional signaling proteins. RGS4 is one of seven members of a classic R4 RGS protein that accelerates the GTPase activity of the Gai/o and Gaq/11 family members. RGS4 is highly expressed in multiple brain regions including the cerebral cortex, amygdala, hippocampus, and striatum. Extensive studies have demonstrated that RGS4 plays an important role in regulating smooth muscle contraction, cardiomyocyte development, neural plasticity and psychiatric disorders. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6029 Product name: Recombinant human RGS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC051869 Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Predict reactive species Full Name: regulator of G-protein signaling 4 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC051869 Gene Symbol: RGS4 Gene ID (NCBI): 5999 RRID: AB_2269443 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924