Iright
BRAND / VENDOR: Proteintech

Proteintech, 14534-1-AP, CASZ1 Polyclonal antibody

CATALOG NUMBER: 14534-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CASZ1 (14534-1-AP) by Proteintech is a Polyclonal antibody targeting CASZ1 in WB, ELISA applications with reactivity to human, mouse samples 14534-1-AP targets CASZ1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SMMC-7721 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Zinc finger protein castor homolog 1 (CASZ1), also known as zinc finger protein 693 (ZNF693), belongs to the C2H2-type zinc finger protein family. CASZ1 is a transcription factor that is evolutionarily conserved and participates in multiple embryonic development and physiological processes. CASZ1 has been found to regulate aldosterone synthesis and repress the activation of aldosterone target genes, suggesting that it may participate in blood pressure regulation. CASZ1 is ubiquitously expressed in various embryonic tissues. Subcellularly, CASZ1 is usually localized in the cell nucleus, consistent with its role in transcription regulation (PMID: 37509718). CASZ1 has two isoforms namely CASZ1a (i.e., hcasz11, 190 kDa) and CASZ1b (i.e., hcasz5, 125 kDa). The observed molecular weights were 150 kDa and 250 kDa, respectively, consistent with descriptions in the literature (PMID: 32060262). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6035 Product name: Recombinant human CASZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 818-1166 aa of BC051883 Sequence: PSLLGAVSSGSAASATPDTPTLVASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVTPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNKMSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCDGQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKPPMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLPASPLATTSLENAKPQVKPGFLQFQEK Predict reactive species Full Name: castor zinc finger 1 Calculated Molecular Weight: 190 kDa Observed Molecular Weight: 150 kDa, 250 kDa GenBank Accession Number: BC051883 Gene Symbol: CASZ1 Gene ID (NCBI): 54897 RRID: AB_3669188 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86V15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924