Proteintech, 14536-1-AP, RPL12 Polyclonal antibody

Size: 20ul / 150ul The RPL12 (14536-1-AP) by Proteintech is a Polyclonal antibody targeting RPL12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14536-1-AP targets RPL12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells Positive IHC detected in: human placenta tissue, human endometrial cancer tissue, mouse brain tissue, mouse stomach tissue, rat brain tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, yeast, c.elegans Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6037 Product name: Recombinant human RPL12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC050644 Sequence: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS Predict reactive species Full Name: ribosomal protein L12 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC050644 Gene Symbol: RPL12 Gene ID (NCBI): 6136 RRID: AB_2269722 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30050 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.