Proteintech, 14547-1-AP, MSRA Polyclonal antibody

Size: 20ul / 150ul The MSRA (14547-1-AP) by Proteintech is a Polyclonal antibody targeting MSRA in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14547-1-AP targets MSRA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, human kidney tissue, mouse kidney tissue, rat kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Methionine sulfoxide reductase A(MSRA), is a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine.MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6053 Product name: Recombinant human MSRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC054033 Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK Predict reactive species Full Name: methionine sulfoxide reductase A Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC054033 Gene Symbol: MSRA Gene ID (NCBI): 4482 RRID: AB_2148366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJ68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.