Proteintech, 14551-1-AP, NAC1 Polyclonal antibody

Size: 20ul / 150ul The NAC1 (14551-1-AP) by Proteintech is a Polyclonal antibody targeting NAC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 14551-1-AP targets NAC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: mouse ovary tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NACC1, also named as BTBD14B and NAC1, belongs to the BTB/POZ family. NACC1 is a transcriptional repressor, which is amplified and overexpressed in various human cancers and plays critical roles in tumor development, progression, and drug resistance (PMID: 31101655). NACC1 has 1 isoform with the molecular mass of 57 kDa. While NAC1 has been shown to repress the transcription of two tumor suppressors, Gadd45-g and Gadd45-g- interacting protein 1, scientists have found that NACC1 also plays an important role in nontranscriptional function, for example, it can act as a bridge for MAVS and TBK1 in RLR-mediated signaling (PMID: 31235549). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6096 Product name: Recombinant human NACC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 173-527 aa of BC055396 Sequence: SDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ Predict reactive species Full Name: nucleus accumbens associated 1, BEN and BTB (POZ) domain containing Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC055396 Gene Symbol: NACC1 Gene ID (NCBI): 112939 RRID: AB_2918036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.