Proteintech, 14566-1-AP, SIAE Polyclonal antibody

Size: 20ul / 150ul The SIAE (14566-1-AP) by Proteintech is a Polyclonal antibody targeting SIAE in WB, ELISA applications with reactivity to human, mouse, rat samples 14566-1-AP targets SIAE in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat heart tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Sialic acids as terminal sugars of N- and O-glycosylated macromolecules are decisive for the functions of glycoconjugates both in soluble form and integrated into cell membranes .The two enzymes responsible for acetylation and de-acetylation have been described as sialate O-acetyltransferase (SOAT) and sialate O-acetylesterase (SIAE), respectively. SIAE deacetylates α(2-6)-linked sialic acid on N-linked glycans of BCR, allowing the interaction with CD22, that functions in vivo as an inhibitor of BCR signaling. (PMID: 26022516) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6143 Product name: Recombinant human SIAE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC068450 Sequence: MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV Predict reactive species Full Name: sialic acid acetylesterase Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: BC068450 Gene Symbol: SIAE Gene ID (NCBI): 54414 RRID: AB_3669189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.