Proteintech, 14584-1-AP, L-Myc Polyclonal antibody

Size: 20ul / 150ul The L-Myc (14584-1-AP) by Proteintech is a Polyclonal antibody targeting L-Myc in WB, ELISA applications with reactivity to human samples 14584-1-AP targets L-Myc in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, U266 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The MYC gene family consists of 3 members, C-MYC, L-MYC, and N-MYC, all of which belong to the superfamily of basic helix-loop-helix leucine zipper (bHLHLZ) DNA binding proteins. L-MYC encodes a nuclear phosphoprotein with 364 amino acids, heterodimerizing with partner protein Max and acts as a transcription factor to control the expression of target genes. L-Myc is involved in many biological processes, including cell proliferation, differentiation, apoptosis and has been found to be amplified and over-expressed in some malignancies. L-Myc amplification has been reported in small-cell lung cancer (PMID: 25528583, 33524794). The observed molecular weight of L-Myc is 68 kDa, which is consistent with the description in the literature (PMID: 8657155). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6105 Product name: Recombinant human MYCL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC011864 Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG Predict reactive species Full Name: v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC011864 Gene Symbol: MYCL1 Gene ID (NCBI): 4610 RRID: AB_3669190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12524 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.