Proteintech, 14586-1-AP, ERCC1 Polyclonal antibody

Size: 20ul / 150ul The ERCC1 (14586-1-AP) by Proteintech is a Polyclonal antibody targeting ERCC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14586-1-AP targets ERCC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human kidney tissue, MCF-7 cells, MDA-MB-231 cells, SKOV-3 cells, T-47D cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human testis tissue, human brain tissue, human ovary tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Excision Repair Cross Complementing 1 (ERCC1) is a structure-specific endonuclease that is responsible for the 5'-incision during DNA repair. It forms a complex with ERCC11, XPF and ERCC4, which are required in both recombinatorial repair and nucleotide excision repair. It has been found that ERCC1, together with RRM1, are determinants of survival after surgical treatment of early-stage, non-small-cell lung cancer. (Ref: Simon, ER. 2005). The calculated molecular weight of ERCC1 is 33 kDa, but the modified ERCC1 is about38 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6112 Product name: Recombinant human ERCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC052813 Sequence: MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC052813 Gene Symbol: ERCC1 Gene ID (NCBI): 2067 RRID: AB_2100027 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07992 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.