Proteintech, 14620-1-AP, TUBGCP5 Polyclonal antibody

Size: 20ul / 150ul The TUBGCP5 (14620-1-AP) by Proteintech is a Polyclonal antibody targeting TUBGCP5 in WB, ELISA applications with reactivity to human, mouse, rat samples 14620-1-AP targets TUBGCP5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:400 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6248 Product name: Recombinant human TUBGCP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 676-1024 aa of BC071560 Sequence: ESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDVLLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAGMEQS Predict reactive species Full Name: tubulin, gamma complex associated protein 5 Calculated Molecular Weight: 118 kDa Observed Molecular Weight: 118-120 kDa GenBank Accession Number: BC071560 Gene Symbol: TUBGCP5 Gene ID (NCBI): 114791 RRID: AB_2878070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.