Proteintech, 14639-1-AP, CHMP1B Polyclonal antibody

Size: 20ul / 150ul The CHMP1B (14639-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP1B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14639-1-AP targets CHMP1B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, human heart tissue, mouse heart tissue, rat heart tissue, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6222 Product name: Recombinant human CHMP1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC065933 Sequence: MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV Predict reactive species Full Name: chromatin modifying protein 1B Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC065933 Gene Symbol: CHMP1B Gene ID (NCBI): 57132 RRID: AB_2079353 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7LBR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.