Iright
BRAND / VENDOR: Proteintech

Proteintech, 14642-1-AP, IGF2BP3 Polyclonal antibody

CATALOG NUMBER: 14642-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IGF2BP3 (14642-1-AP) by Proteintech is a Polyclonal antibody targeting IGF2BP3 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 14642-1-AP targets IGF2BP3 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, BxPC-3 cells, HeLa cells, HepG2 cells, mouse brain tissue, mouse placenta tissue, NIH/3T3 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information IGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6226 Product name: Recombinant human IGF2BP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-579 aa of BC065269 Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK Predict reactive species Full Name: insulin-like growth factor 2 mRNA binding protein 3 Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC065269 Gene Symbol: IGF2BP3 Gene ID (NCBI): 10643 RRID: AB_2122782 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00425 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924