Product Description
Size: 20ul / 150ul
RPL37A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
14660-1-AP targets RPL37A in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: COLO 320 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells
Positive IP detected in: MCF-7 cells
Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: SH-SY5Y cells
Positive FC (Intra) detected in: MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag6330 Product name: Recombinant human RPL37A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC063476 Sequence: MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYK Predict reactive species
Full Name: ribosomal protein L37a
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC063476
Gene Symbol: RPL37A
Gene ID (NCBI): 6168
RRID: AB_2238668
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P61513
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924