Proteintech, 14674-1-AP, ADHFE1 Polyclonal antibody

Size: 20ul / 150ul The ADHFE1 (14674-1-AP) by Proteintech is a Polyclonal antibody targeting ADHFE1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14674-1-AP targets ADHFE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue Positive IHC detected in: human colon tissue, human colon cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information The ADHFE1 gene encodes hydroxyacid-oxoacid transhydrogenase which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues. It belongs to the iron-containing alcohol dehydrogenase family. ADHFE1 has 4 isoforms produced by alternative splicing with the MW of 50, 45, 32, 27 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6382 Product name: Recombinant human ADHFE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC064634 Sequence: MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNSTDK Predict reactive species Full Name: alcohol dehydrogenase, iron containing, 1 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa, 40-45 kDa GenBank Accession Number: BC064634 Gene Symbol: ADHFE1 Gene ID (NCBI): 137872 RRID: AB_2221451 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.