Iright
BRAND / VENDOR: Proteintech

Proteintech, 14684-1-AP, RXRB Polyclonal antibody

CATALOG NUMBER: 14684-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RXRB (14684-1-AP) by Proteintech is a Polyclonal antibody targeting RXRB in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14684-1-AP targets RXRB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, MCF-7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Retinoid X Receptor beta (RXRB) is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid. RXRB heterodimerizes with other nuclear hormone receptors, such as RAR, the thyroid hormone receptor and the vitamin D3 receptor, to enhance binding to their cognate response elements. (PMID: 8257090) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0263 Product name: Recombinant human RXRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-238 aa of BC001167 Sequence: RDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLT Predict reactive species Full Name: retinoid X receptor, beta Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa, 70 kDa GenBank Accession Number: BC001167 Gene Symbol: RXRB Gene ID (NCBI): 6257 RRID: AB_10858228 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924