Iright
BRAND / VENDOR: Proteintech

Proteintech, 14686-1-AP, CRMP2 Polyclonal antibody

CATALOG NUMBER: 14686-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRMP2 (14686-1-AP) by Proteintech is a Polyclonal antibody targeting CRMP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14686-1-AP targets CRMP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, mouse brain tissue, rat brain tissue, SH-SY5Y cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Dihydropyrimidinase-like 2 (Dpysl2), a protein involved in neuronal differentiation and axonal guidance is found altered in various nervous system diseases (PMID:19524114). It is also named as CRMP2, ULIP2 and belongs to hydantoinase/dihydropyrimidinase subfamily. The phosphorylation of the particular portion carboxyl-terminal to the basic region of DPYSL2 may play an important role in regulating its activity, and may be involved in the formation of degenerating neurites in AD brain(PMID:10757975). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5985 Product name: Recombinant human DPYSL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 223-572 aa of BC056408 Sequence: HVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG Predict reactive species Full Name: dihydropyrimidinase-like 2 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62-66 kDa GenBank Accession Number: BC056408 Gene Symbol: CRMP2 Gene ID (NCBI): 1808 RRID: AB_10638925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16555 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924