Iright
BRAND / VENDOR: Proteintech

Proteintech, 14699-1-AP, ATF7IP Polyclonal antibody

CATALOG NUMBER: 14699-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATF7IP (14699-1-AP) by Proteintech is a Polyclonal antibody targeting ATF7IP in IHC, ELISA applications with reactivity to human, mouse, rat samples 14699-1-AP targets ATF7IP in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ATF7IP (Activating Transcription Factor 7 Interacting Protein), also known as MCAF1 (MBD1-containing chromatin-associated factor 1), is a multifunctional scaffold protein that plays a pivotal role in epigenetic regulation and transcriptional control. Functionally, ATF7IP acts as an adaptor that recruits the histone methyltransferase SETDB1 to specific genomic loci, facilitating the deposition of the heterochromatin mark H3K9me3 and silencing target genes, including retrotransposons such as LINE1. This activity is essential for maintaining genomic stability by suppressing transposable element mobilization and preventing DNA damage. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6341 Product name: Recombinant human ATF7IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 756-1106 aa of BC063855 Sequence: NTATVVATTQVPSGNPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPNPTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSPSTNRGPIQMKIPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPAQAPLRGTVMQAPAVRQVNPQNSKRFFLYMAPRYM Predict reactive species Full Name: activating transcription factor 7 interacting protein Calculated Molecular Weight: 137 kDa GenBank Accession Number: BC063855 Gene Symbol: ATF7IP Gene ID (NCBI): 55729 RRID: AB_2878074 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6VMQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924