Proteintech, 14702-1-AP, MAP4K3 Polyclonal antibody

Size: 20ul / 150ul The MAP4K3 (14702-1-AP) by Proteintech is a Polyclonal antibody targeting MAP4K3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14702-1-AP targets MAP4K3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, HeLa cells, human brain tissue Positive IHC detected in: human skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MAP4K3(Mitogen-activated protein kinase kinase kinase kinase 3) has kinase activity and that it activates JNK but not MAPK1, MAPK3 or MAPK14 through the activation of MAP3K1 and MAP2K4. Endogenous MAP4K3 kinase activity could be stimulated by exposure to ultraviolet radiation or to tumor necrosis factor. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6372 Product name: Recombinant human MAP4K3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 537-873 aa of BC071579 Sequence: KIHCASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase kinase 3 Calculated Molecular Weight: 101 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC071579 Gene Symbol: MAP4K3 Gene ID (NCBI): 8491 RRID: AB_10858917 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.