Proteintech, 14704-1-AP, C14orf2 Polyclonal antibody

Size: 20ul / 150ul The C14orf2 (14704-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf2 in WB, IP, IHC, ELISA applications with reactivity to human samples 14704-1-AP targets C14orf2 in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, human brain tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6386 Product name: Recombinant human C14orf2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-58 aa of BC001944 Sequence: MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH Predict reactive species Full Name: chromosome 14 open reading frame 2 Calculated Molecular Weight: 7 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC001944 Gene Symbol: C14orf2 Gene ID (NCBI): 9556 RRID: AB_2228192 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56378 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.