Proteintech, 14722-1-AP, DAPP1 Polyclonal antibody

Size: 20ul / 150ul The DAPP1 (14722-1-AP) by Proteintech is a Polyclonal antibody targeting DAPP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14722-1-AP targets DAPP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information DAPP1 was identified as dual adaptor for phosphotyrosine and 3-phosphoinositides, a novel 280 amino acid protein which contains a putative myristoylation site at its N-terminus followed by a SH2 and a PH domain at its C-terminus (PMID: 10432293). DAPP1 is also referred to B cell adaptor molecule of 32 kDa (Bam32), and is expressed by B lymphocytes, but not T lymphocytes or nonhematopoietic cells. DAPP1/Bam32 was shown to regulate BCR signaling downstream of phosphatidylinositol 3-kinase (PI3K) (PMID: 10770799). Furthermore, DAPP1/Bam32 may server to integrate PI3K and Src kinase signaling to promote Rac-dependent B cell adhesive interactions important for antigen presentation function (PMID: 20495066). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6459 Product name: Recombinant human DAPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC012924 Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK Predict reactive species Full Name: dual adaptor of phosphotyrosine and 3-phosphoinositides Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC012924 Gene Symbol: DAPP1 Gene ID (NCBI): 27071 RRID: AB_2088457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.