Proteintech, 14739-1-AP, CYP27A1 Polyclonal antibody

Size: 20ul / 150ul The CYP27A1 (14739-1-AP) by Proteintech is a Polyclonal antibody targeting CYP27A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14739-1-AP targets CYP27A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, NIH/3T3 cells Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Mitochondrial sterol 27-hydroxylase (CYP27A1) catalyzes oxidative cleavage of the sterol side chain in the bile acid biosynthetic pathway in the liver and 27-hydroxylation of cholesterol in most tissues(PMID:17088262). It belongs to the cytochrome P450 family. CYP27A1 catalyses an important sterol elimination pathway in the macrophage, and consequently may protect against atherosclerosis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6408 Product name: Recombinant human CYP27A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 183-531 aa of BC051851 Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC Predict reactive species Full Name: cytochrome P450, family 27, subfamily A, polypeptide 1 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC051851 Gene Symbol: CYP27A1 Gene ID (NCBI): 1593 RRID: AB_2089276 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.