Proteintech, 14747-1-AP, SDF2 Polyclonal antibody

Size: 20ul / 150ul The SDF2 (14747-1-AP) by Proteintech is a Polyclonal antibody targeting SDF2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14747-1-AP targets SDF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HUVEC cells, mouse heart, U2OS cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SDF-2 is a small protein of 211 amino acids that is ubiquitously expressed in lung, breast, colon, liver and kidney. SDF-2 is localized in the ER and has been reported to get involved in multiple endoplasmic reticulum (ER) functions, including the misfolded protein catabolic process, protein glycosylation, and ER protein quality control. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6480 Product name: Recombinant human SDF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-211 aa of BC000500 Sequence: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL Predict reactive species Full Name: stromal cell-derived factor 2 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC000500 Gene Symbol: SDF2 Gene ID (NCBI): 6388 RRID: AB_2918037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99470 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.