Iright
BRAND / VENDOR: Proteintech

Proteintech, 14753-1-AP, SEC11A Polyclonal antibody

CATALOG NUMBER: 14753-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEC11A (14753-1-AP) by Proteintech is a Polyclonal antibody targeting SEC11A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14753-1-AP targets SEC11A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HeLa cells, human colon tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SEC11A(Signal peptidase complex catalytic subunit SEC11A) is also named as SEC11L1, SPC18, SPCS4A and belongs to the peptidase S26B family. It is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. SEC11A has some isoforms with the molecular mass of 17-21 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6500 Product name: Recombinant human SEC11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC000359 Sequence: MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE Predict reactive species Full Name: SEC11 homolog A (S. cerevisiae) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 17-21 kDa GenBank Accession Number: BC000359 Gene Symbol: SEC11A Gene ID (NCBI): 23478 RRID: AB_2186230 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P67812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924