Proteintech, 14776-1-AP, SEC22B Polyclonal antibody

Size: 20ul / 150ul The SEC22B (14776-1-AP) by Proteintech is a Polyclonal antibody targeting SEC22B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14776-1-AP targets SEC22B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, rat liver tissue, mouse brain tissue, rat brain tissue, MDA-MB-231 cells Positive IHC detected in: human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6077 Product name: Recombinant human SEC22B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-215 aa of BC001364 Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL Predict reactive species Full Name: SEC22 vesicle trafficking protein homolog B (S. cerevisiae) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001364 Gene Symbol: SEC22B Gene ID (NCBI): 9554 RRID: AB_2186083 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75396 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.