Proteintech, 14789-1-AP, SNRPD2 Polyclonal antibody

Size: 20ul / 150ul The SNRPD2 (14789-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD2 in WB, IHC, ELISA applications with reactivity to human samples 14789-1-AP targets SNRPD2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, A549 cells, HL-60 cells Positive IHC detected in: human skin tissue, human lung cancer tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6443 Product name: Recombinant human SNRPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000486 Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Predict reactive species Full Name: small nuclear ribonucleoprotein D2 polypeptide 16.5kDa Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC000486 Gene Symbol: SNRPD2 Gene ID (NCBI): 6633 RRID: AB_10898359 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62316 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.