Iright
BRAND / VENDOR: Proteintech

Proteintech, 14794-1-AP, NDUFB8 Polyclonal antibody

CATALOG NUMBER: 14794-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFB8 (14794-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB8 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14794-1-AP targets NDUFB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, A549 cells, various samples, 3T3-L1 cells, mouse brain tissue, mouse liver tissue, rat brain tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver tissue, human heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6495 Product name: Recombinant human NDUFB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC000466 Sequence: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 19-22 kDa GenBank Accession Number: BC000466 Gene Symbol: NDUFB8 Gene ID (NCBI): 4714 RRID: AB_2150970 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95169 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924