Proteintech, 14800-1-AP, GOT2 Polyclonal antibody

Size: 20ul / 150ul The GOT2 (14800-1-AP) by Proteintech is a Polyclonal antibody targeting GOT2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 14800-1-AP targets GOT2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, mouse heart tissue, mouse spleen tissue, HEK-293 cells, mouse brain, rat brain Positive IHC detected in: human breast cancer tissue, human skin tissue, rat brain tissue, human liver tissue, rat heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GOT2 encodes the mitochondrial glutamate oxaloacetate transaminase and plays an essential role in the intracellular NAD(H) redox balance. Upregulation of GOT2 has been reported in various cancers, including breast cancer and pancreatic cancer. GOT2 mutation leads to autosomal recessive neurometabolic disorder. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6514 Product name: Recombinant human GOT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-430 aa of BC000525 Sequence: KAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK Predict reactive species Full Name: glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 43-45 kDa GenBank Accession Number: BC000525 Gene Symbol: GOT2 Gene ID (NCBI): 2806 RRID: AB_2247898 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00505 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.